Lineage for d4yxwe1 (4yxw E:9-81)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798867Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)
  8. 2798896Domain d4yxwe1: 4yxw E:9-81 [272504]
    Other proteins in same PDB: d4yxwa2, d4yxwa3, d4yxwb2, d4yxwb3, d4yxwc2, d4yxwc3, d4yxwd2, d4yxwd3, d4yxwe2, d4yxwe3, d4yxwf2, d4yxwf3, d4yxwh1, d4yxwh2, d4yxwi_
    automated match to d1mabb2
    complexed with anp, cl, mg, na, ts6

Details for d4yxwe1

PDB Entry: 4yxw (more details), 3.1 Å

PDB Description: bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4yxwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxwe1 b.49.1.0 (E:9-81) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d4yxwe1:

Click to download the PDB-style file with coordinates for d4yxwe1.
(The format of our PDB-style files is described here.)

Timeline for d4yxwe1: