Lineage for d4yxwf3 (4yxw F:358-474)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717574Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 2717604Domain d4yxwf3: 4yxw F:358-474 [272503]
    Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwb1, d4yxwb2, d4yxwc1, d4yxwc2, d4yxwd1, d4yxwd2, d4yxwe1, d4yxwe2, d4yxwf1, d4yxwf2, d4yxwh1, d4yxwh2, d4yxwi_
    automated match to d1mabb1
    complexed with anp, cl, mg, na, ts6

Details for d4yxwf3

PDB Entry: 4yxw (more details), 3.1 Å

PDB Description: bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4yxwf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxwf3 a.69.1.0 (F:358-474) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d4yxwf3:

Click to download the PDB-style file with coordinates for d4yxwf3.
(The format of our PDB-style files is described here.)

Timeline for d4yxwf3: