![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
![]() | Domain d4yxwa3: 4yxw A:380-510 [272500] Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwb1, d4yxwb2, d4yxwc1, d4yxwc2, d4yxwd1, d4yxwd2, d4yxwe1, d4yxwe2, d4yxwf1, d4yxwf2, d4yxwh1, d4yxwh2, d4yxwi_ automated match to d1maba1 complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxwa3 a.69.1.0 (A:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d4yxwa3: