SCOPe 2.06: Domain d2izba_: 2izb A:

Lineage for d2izba_ (2izb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d2izba_: 2izb A: [27250]
   complexed with fmt, so4

Details for d2izba_

PDB Entry: 2izb, 1.2 Å

PDB Description: apostreptavidin ph 3.12 i4122 structure

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2izba_:

Sequence; same for both SEQRES and ATOM records:

>d2izba_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vk

Timeline for d2izba_:

• d2izba_ first appeared (with stable ids) in SCOP 1.55, called d2izb__
  
• d2izba_ appears in SCOPe 2.05
  
• d2izba_ appears in SCOPe 2.07
  
• d2izba_ appears in the current release, SCOPe 2.08