![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) ![]() automatically mapped to Pfam PF04627 |
![]() | Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins) |
![]() | Protein automated matches [190373] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187216] (5 PDB entries) |
![]() | Domain d4yxwi_: 4yxw I: [272497] Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwa3, d4yxwb1, d4yxwb2, d4yxwb3, d4yxwc1, d4yxwc2, d4yxwc3, d4yxwd1, d4yxwd2, d4yxwd3, d4yxwe1, d4yxwe2, d4yxwe3, d4yxwf1, d4yxwf2, d4yxwf3, d4yxwh1, d4yxwh2 automated match to d1e79i_ complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxwi_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]} vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv
Timeline for d4yxwi_: