Lineage for d4ypgd_ (4ypg D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1730528Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1730529Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1730819Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 protein domains)
    contains an additional helix in one of the crossover connections
  6. 1730914Protein automated matches [190141] (2 species)
    not a true protein
  7. 1730915Species Human (Homo sapiens) [TaxId:9606] [187124] (5 PDB entries)
  8. 1730923Domain d4ypgd_: 4ypg D: [272488]
    Other proteins in same PDB: d4ypga1, d4ypga2, d4ypgl1, d4ypgl2
    automated match to d1itfa_
    complexed with ni

Details for d4ypgd_

PDB Entry: 4ypg (more details), 3 Å

PDB Description: structural insights into the neutralization properties of a human anti-interferon monoclonal antibody
PDB Compounds: (D:) Interferon alpha-2

SCOPe Domain Sequences for d4ypgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypgd_ a.26.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tscdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhe
miqqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsila
vrkyfqritlylkekkyspcawevvraeimrsfslstnlqe

SCOPe Domain Coordinates for d4ypgd_:

Click to download the PDB-style file with coordinates for d4ypgd_.
(The format of our PDB-style files is described here.)

Timeline for d4ypgd_:

  • d4ypgd_ appears in periodic updates to SCOPe 2.05 starting on 2015-05-07
  • d4ypgd_ appears in the current release, SCOPe 2.06, called d4ypgd1