Lineage for d4yf4c_ (4yf4 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857166Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1857284Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 1857285Protein automated matches [190830] (7 species)
    not a true protein
  7. 1857311Species Mycobacterium tuberculosis [TaxId:83331] [272473] (3 PDB entries)
  8. 1857314Domain d4yf4c_: 4yf4 C: [272487]
    automated match to d1ylka_
    complexed with cl, mg, zn

Details for d4yf4c_

PDB Entry: 4yf4 (more details), 1.8 Å

PDB Description: crystal structure of rv1284 in the presence of polycarpine at mildly acidic ph
PDB Compounds: (C:) Beta-carbonic anhydrase 1

SCOPe Domain Sequences for d4yf4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yf4c_ c.53.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

SCOPe Domain Coordinates for d4yf4c_:

Click to download the PDB-style file with coordinates for d4yf4c_.
(The format of our PDB-style files is described here.)

Timeline for d4yf4c_: