Lineage for d4yf5c1 (4yf5 C:2-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883243Species Mycobacterium tuberculosis [TaxId:83331] [272473] (3 PDB entries)
  8. 2883250Domain d4yf5c1: 4yf5 C:2-163 [272481]
    Other proteins in same PDB: d4yf5a2, d4yf5b2, d4yf5c2, d4yf5d2
    automated match to d1ylka_
    complexed with cl, zn

Details for d4yf5c1

PDB Entry: 4yf5 (more details), 2 Å

PDB Description: crystal structure of rv1284 in the presence of polycarpine at acidic ph
PDB Compounds: (C:) Beta-carbonic anhydrase 1

SCOPe Domain Sequences for d4yf5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yf5c1 c.53.2.0 (C:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
tvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagc
vvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesyp
davedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

SCOPe Domain Coordinates for d4yf5c1:

Click to download the PDB-style file with coordinates for d4yf5c1.
(The format of our PDB-style files is described here.)

Timeline for d4yf5c1: