Lineage for d1df8a_ (1df8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2396687Protein Streptavidin [50878] (1 species)
  7. 2396688Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)
  8. 2396731Domain d1df8a_: 1df8 A: [27248]
    complexed with btn; mutant

Details for d1df8a_

PDB Entry: 1df8 (more details), 1.51 Å

PDB Description: s45a mutant of streptavidin in complex with biotin
PDB Compounds: (A:) protein (streptavidin)

SCOPe Domain Sequences for d1df8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df8a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1df8a_:

Click to download the PDB-style file with coordinates for d1df8a_.
(The format of our PDB-style files is described here.)

Timeline for d1df8a_: