SCOPe 2.08: Domain d4yf4a1: 4yf4 A:2-163

Lineage for d4yf4a1 (4yf4 A:2-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (15 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [272473] (3 PDB entries)

8. Domain d4yf4a1: 4yf4 A:2-163 [272478]
   Other proteins in same PDB: d4yf4a2, d4yf4b2, d4yf4c2, d4yf4d2
   automated match to d1ylka_
   complexed with cl, mg, zn

Details for d4yf4a1

PDB Entry: 4yf4, 1.8 Å

PDB Description: crystal structure of rv1284 in the presence of polycarpine at mildly acidic ph

PDB Compounds: (A:) Beta-carbonic anhydrase 1

SCOPe Domain Sequences for d4yf4a1:

Sequence; same for both SEQRES and ATOM records:

>d4yf4a1 c.53.2.0 (A:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
tvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagc
vvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesyp
davedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

Timeline for d4yf4a1:

• d4yf4a1 first appeared in SCOPe 2.05, called d4yf4a_
  
• d4yf4a1 appears in SCOPe 2.07