SCOPe 2.05: Domain d4yf5d_: 4yf5 D:

Lineage for d4yf5d_ (4yf5 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (7 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [272473] (3 PDB entries)

8. Domain d4yf5d_: 4yf5 D: [272475]
   automated match to d1ylka_
   complexed with cl, zn

Details for d4yf5d_

PDB Entry: 4yf5, 2 Å

PDB Description: crystal structure of rv1284 in the presence of polycarpine at acidic ph

PDB Compounds: (D:) Beta-carbonic anhydrase 1

SCOPe Domain Sequences for d4yf5d_:

Sequence; same for both SEQRES and ATOM records:

>d4yf5d_ c.53.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

Timeline for d4yf5d_:

• d4yf5d_ is new in SCOPe 2.05-stable
  
• d4yf5d_ is called d4yf5d1 in SCOPe 2.06
  
• d4yf5d_ appears in the current release, SCOPe 2.08, called d4yf5d1