SCOPe 2.05: Domain d4xvsl2: 4xvs L:108-216

Lineage for d4xvsl2 (4xvs L:108-216)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4xvsl2: 4xvs L:108-216 [272471]
   automated match to d4om1l2
   complexed with nag

Details for d4xvsl2

PDB Entry: 4xvs, 1.9 Å

PDB Description: crystal structure of hiv-1 donor 45 d45-01dg5 coree gp120 with antibody 45-vrc01.h01+07.o-863513/45-vrc01.l01+07.o-110653 (vrc07_1995)

PDB Compounds: (L:) 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain

SCOPe Domain Sequences for d4xvsl2:

Sequence; same for both SEQRES and ATOM records:

>d4xvsl2 b.1.1.0 (L:108-216) automated matches {Homo sapiens [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglaspvtksfnrgec

Timeline for d4xvsl2:

• d4xvsl2 is new in SCOPe 2.05-stable
  
• d4xvsl2 appears in SCOPe 2.06
  
• d4xvsl2 appears in the current release, SCOPe 2.08