SCOPe 2.08: Domain d4xvsl1: 4xvs L:3-107

Lineage for d4xvsl1 (4xvs L:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4xvsl1: 4xvs L:3-107 [272470]
   automated match to d3u7wl1
   complexed with nag

Details for d4xvsl1

PDB Entry: 4xvs, 1.9 Å

PDB Description: crystal structure of hiv-1 donor 45 d45-01dg5 coree gp120 with antibody 45-vrc01.h01+07.o-863513/45-vrc01.l01+07.o-110653 (vrc07_1995)

PDB Compounds: (L:) 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain

SCOPe Domain Sequences for d4xvsl1:

Sequence; same for both SEQRES and ATOM records:

>d4xvsl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrtsqygslawyqqrpgqaprlviyggssratgipdrf
tgsrsgadytltinrlepedfgiyycqqyeffgqgtkvevd

Timeline for d4xvsl1:

• d4xvsl1 first appeared in SCOPe 2.05
  
• d4xvsl1 appears in SCOPe 2.07