Lineage for d2rtj__ (2rtj -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.61: Streptavidin-like [50875] (3 superfamilies) Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) 
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) Protein Streptavidin [50878] (1 species) Species Streptomyces avidinii [TaxId:1895] [50879] (84 PDB entries) 
Domain d2rtj__: 2rtj - [27247]
Details for d2rtj__
PDB Entry: 2rtj (more details), 1.43 Å
PDB Description: streptavidin-glycoluril complex, ph 2.50, space group i4122
SCOP Domain Sequences for d2rtj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rtj__ b.61.1.1 (-) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp
SCOP Domain Coordinates for d2rtj__:
Click to download the PDB-style file with coordinates for d2rtj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rtj__:
- d2rtj__ appears in SCOP 1.57
- d2rtj__ appears in the current release, SCOPe 2.08, called d2rtja_
View in 3D