SCOPe 2.08: Domain d2rtja_: 2rtj A:

Lineage for d2rtja_ (2rtj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d2rtja_: 2rtj A: [27247]
   complexed with fmt, gll

Details for d2rtja_

PDB Entry: 2rtj, 1.4 Å

PDB Description: streptavidin-glycoluril complex, ph 2.50, space group i4122

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2rtja_:

Sequence; same for both SEQRES and ATOM records:

>d2rtja_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtja_:

• d2rtja_ first appeared (with stable ids) in SCOP 1.55, called d2rtj__
  
• d2rtja_ appears in SCOPe 2.07