SCOPe 2.07: Domain d4y2qa2: 4y2q A:228-547

Lineage for d4y2qa2 (4y2q A:228-547)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102626] (41 PDB entries)

8. Domain d4y2qa2: 4y2q A:228-547 [272464]
   Other proteins in same PDB: d4y2qa1
   automated match to d3i28a2
   complexed with 49n, mg

Details for d4y2qa2

PDB Entry: 4y2q, 2.4 Å

PDB Description: structure of soluble epoxide hydrolase in complex with 1-[3- (trifluoromethyl)pyridin-2-yl]piperazine

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4y2qa2:

Sequence; same for both SEQRES and ATOM records:

>d4y2qa2 c.69.1.11 (A:228-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdar

Timeline for d4y2qa2:

• d4y2qa2 first appeared in SCOPe 2.05
  
• d4y2qa2 appears in SCOPe 2.06
  
• d4y2qa2 appears in the current release, SCOPe 2.08