Lineage for d2izld_ (2izl D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62327Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 62328Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 62343Protein Streptavidin [50878] (1 species)
  7. 62344Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)
  8. 62354Domain d2izld_: 2izl D: [27246]

Details for d2izld_

PDB Entry: 2izl (more details), 1.48 Å

PDB Description: streptavidin-2-iminobiotin ph 7.3 i222 complex

SCOP Domain Sequences for d2izld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izld_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d2izld_:

Click to download the PDB-style file with coordinates for d2izld_.
(The format of our PDB-style files is described here.)

Timeline for d2izld_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2izlb_