![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102626] (49 PDB entries) |
![]() | Domain d4y2xa2: 4y2x A:228-547 [272454] Other proteins in same PDB: d4y2xa1 automated match to d3i28a2 complexed with 4a0, mg |
PDB Entry: 4y2x (more details), 2.5 Å
SCOPe Domain Sequences for d4y2xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y2xa2 c.69.1.11 (A:228-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq mdkptevnqilikwldsdar
Timeline for d4y2xa2: