SCOPe 2.08: Domain d4xp1l1: 4xp1 L:1-108

Lineage for d4xp1l1 (4xp1 L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4xp1l1: 4xp1 L:1-108 [272447]
   Other proteins in same PDB: d4xp1h_, d4xp1l2
   automated match to d2i9la1
   complexed with cl, clr, edo, ldp, na, nag, p4g, y01

Details for d4xp1l1

PDB Entry: 4xp1, 2.89 Å

PDB Description: x-ray structure of drosophila dopamine transporter bound to neurotransmitter dopamine

PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d4xp1l1:

Sequence; same for both SEQRES and ATOM records:

>d4xp1l1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk

Timeline for d4xp1l1:

• d4xp1l1 first appeared in SCOPe 2.05
  
• d4xp1l1 appears in SCOPe 2.07