SCOPe 2.08: Domain d4xphl2: 4xph L:109-214

Lineage for d4xphl2 (4xph L:109-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4xphl2: 4xph L:109-214 [272446]
   Other proteins in same PDB: d4xphh_, d4xphl1
   automated match to d3mbxl2
   complexed with 42j, cl, clr, na, p4g; mutant

Details for d4xphl2

PDB Entry: 4xph, 2.9 Å

PDB Description: x-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to 3,4dichlorophenethylamine

PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d4xphl2:

Sequence; same for both SEQRES and ATOM records:

>d4xphl2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkiegserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4xphl2:

• d4xphl2 first appeared in SCOPe 2.05
  
• d4xphl2 appears in SCOPe 2.07