| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4xphl1: 4xph L:1-108 [272445] Other proteins in same PDB: d4xphh_, d4xphl2 automated match to d2g2ra1 complexed with 42j, cl, clr, na, p4g; mutant |
PDB Entry: 4xph (more details), 2.9 Å
SCOPe Domain Sequences for d4xphl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xphl1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk
Timeline for d4xphl1: