Lineage for d4xphl1 (4xph L:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760718Domain d4xphl1: 4xph L:1-108 [272445]
    Other proteins in same PDB: d4xphh_, d4xphl2
    automated match to d2g2ra1
    complexed with 42j, cl, clr, na, p4g; mutant

Details for d4xphl1

PDB Entry: 4xph (more details), 2.9 Å

PDB Description: x-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to 3,4dichlorophenethylamine
PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d4xphl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xphl1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk

SCOPe Domain Coordinates for d4xphl1:

Click to download the PDB-style file with coordinates for d4xphl1.
(The format of our PDB-style files is described here.)

Timeline for d4xphl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xphl2
View in 3D
Domains from other chains:
(mouse over for more information)
d4xphh_