SCOPe 2.08: Domain d4xp9l2: 4xp9 L:109-213

Lineage for d4xp9l2 (4xp9 L:109-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4xp9l2: 4xp9 L:109-213 [272442]
   Other proteins in same PDB: d4xp9h_, d4xp9l1
   automated match to d1f3dj2
   complexed with 1we, cl, clr, mpo, na, nag, p4g, y01

Details for d4xp9l2

PDB Entry: 4xp9, 2.8 Å

PDB Description: x-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine

PDB Compounds: (L:) antibody fragment heavy chain-protein, 9d5-heavy chain

SCOPe Domain Sequences for d4xp9l2:

Sequence; same for both SEQRES and ATOM records:

>d4xp9l2 b.1.1.2 (L:109-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkiegserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4xp9l2:

• d4xp9l2 first appeared in SCOPe 2.05
  
• d4xp9l2 appears in SCOPe 2.07