Lineage for d2rtgd_ (2rtg D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16670Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 16671Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 16684Protein Streptavidin [50878] (1 species)
  7. 16685Species Streptomyces avidinii [TaxId:1895] [50879] (84 PDB entries)
  8. 16698Domain d2rtgd_: 2rtg D: [27244]

Details for d2rtgd_

PDB Entry: 2rtg (more details), 1.39 Å

PDB Description: streptavidin-biotin complex, ph 2.40, space group i222

SCOP Domain Sequences for d2rtgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtgd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d2rtgd_:

Click to download the PDB-style file with coordinates for d2rtgd_.
(The format of our PDB-style files is described here.)

Timeline for d2rtgd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rtgb_