Lineage for d4y1lc_ (4y1l C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898688Species Human (Homo sapiens) [TaxId:9606] [186843] (16 PDB entries)
  8. 1898707Domain d4y1lc_: 4y1l C: [272436]
    Other proteins in same PDB: d4y1la_, d4y1lb_
    automated match to d2ebka_

Details for d4y1lc_

PDB Entry: 4y1l (more details), 2.7 Å

PDB Description: ubc9 homodimer the missing link in poly-sumo chain formation
PDB Compounds: (C:) RWD domain-containing protein 3

SCOPe Domain Sequences for d4y1lc_:

Sequence, based on SEQRES records: (download)

>d4y1lc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdvdiplelvfhlpvny
psclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqenlrha

Sequence, based on observed residues (ATOM records): (download)

>d4y1lc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmplelvfhlpvnypscl
pgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqenlrha

SCOPe Domain Coordinates for d4y1lc_:

Click to download the PDB-style file with coordinates for d4y1lc_.
(The format of our PDB-style files is described here.)

Timeline for d4y1lc_:

  • d4y1lc_ appears in periodic updates to SCOPe 2.05 starting on 2015-05-06
  • d4y1lc_ is called d4y1lc1 in SCOPe 2.06
  • d4y1lc_ appears in the current release, SCOPe 2.07, called d4y1lc1