| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (42 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries) |
| Domain d4xy5a_: 4xy5 A: [272434] automated match to d3lbeb_ mutant |
PDB Entry: 4xy5 (more details), 1.8 Å
SCOPe Domain Sequences for d4xy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xy5a_ d.38.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
hfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcaqisglvvislgl
dgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftmfvtg
q
Timeline for d4xy5a_: