Lineage for d4xy5a_ (4xy5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944632Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries)
  8. 2944633Domain d4xy5a_: 4xy5 A: [272434]
    automated match to d3lbeb_
    mutant

Details for d4xy5a_

PDB Entry: 4xy5 (more details), 1.8 Å

PDB Description: crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4
PDB Compounds: (A:) Hypothetical Thioesterase Protein SP_1851

SCOPe Domain Sequences for d4xy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xy5a_ d.38.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
hfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcaqisglvvislgl
dgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftmfvtg
q

SCOPe Domain Coordinates for d4xy5a_:

Click to download the PDB-style file with coordinates for d4xy5a_.
(The format of our PDB-style files is described here.)

Timeline for d4xy5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4xy5b_