Lineage for d4wwse_ (4wws E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907280Species Listeria monocytogenes [TaxId:169963] [272416] (1 PDB entry)
  8. 1907285Domain d4wwse_: 4wws E: [272421]
    automated match to d1vdha_
    complexed with k

Details for d4wwse_

PDB Entry: 4wws (more details), 2 Å

PDB Description: structure of chlorite dismutase-like protein from listeria monocytogenes
PDB Compounds: (E:) Putative heme-dependent peroxidase lmo2113

SCOPe Domain Sequences for d4wwse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwse_ d.58.4.0 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]}
vktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysil
gqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggddp
yqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagk
vqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseq
lsklfti

SCOPe Domain Coordinates for d4wwse_:

Click to download the PDB-style file with coordinates for d4wwse_.
(The format of our PDB-style files is described here.)

Timeline for d4wwse_: