Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (21 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [272416] (1 PDB entry) |
Domain d4wwse_: 4wws E: [272421] automated match to d1vdha_ complexed with k |
PDB Entry: 4wws (more details), 2 Å
SCOPe Domain Sequences for d4wwse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwse_ d.58.4.0 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]} vktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysil gqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggddp yqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagk vqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseq lsklfti
Timeline for d4wwse_:
View in 3D Domains from other chains: (mouse over for more information) d4wwsa_, d4wwsb_, d4wwsc_, d4wwsd_ |