Lineage for d2rtib_ (2rti B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 378913Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 378914Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 378937Protein Streptavidin [50878] (1 species)
  7. 378938Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)
  8. 378964Domain d2rtib_: 2rti B: [27241]

Details for d2rtib_

PDB Entry: 2rti (more details), 1.4 Å

PDB Description: streptavidin-glycoluril complex, ph 2.50, space group i222

SCOP Domain Sequences for d2rtib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtib_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d2rtib_:

Click to download the PDB-style file with coordinates for d2rtib_.
(The format of our PDB-style files is described here.)

Timeline for d2rtib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rtid_