Lineage for d4tsra_ (4tsr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128187Protein automated matches [196302] (3 species)
    not a true protein
  7. 2128194Species Escherichia coli [TaxId:562] [272386] (1 PDB entry)
  8. 2128195Domain d4tsra_: 4tsr A: [272387]
    automated match to d1dkqa_
    complexed with ihs, ni; mutant

Details for d4tsra_

PDB Entry: 4tsr (more details), 2.07 Å

PDB Description: the complex structure of mutant phytase with ihs
PDB Compounds: (A:) Periplasmic AppA protein

SCOPe Domain Sequences for d4tsra_:

Sequence, based on SEQRES records: (download)

>d4tsra_ c.60.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
lklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghyqrqr
lvadgllakkgcpqsgqvaiiadtdertrktgeafaaglapdcaitvhtqvdtsspdplf
nplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkrekqd
escsltqalpselkvsadnvaltgavslasmlteifllqqaqgmpepgwgritdshqwnt
llslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdt
nlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktp
lslntppgevkltlagceernaqgmcslagftqivnearipacsl

Sequence, based on observed residues (ATOM records): (download)

>d4tsra_ c.60.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
lklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghyqrqr
lvadgllakkgcpqsgqvaiiadtdertrktgeafaaglapdcaitvhtqvdtsspdplf
nplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkrcslt
qalpselkvsadnvaltgavslasmlteifllqqaqgmpepgwgritdshqwntllslhn
aqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdtnlanlg
galelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktplslntp
pgevkltlagceernaqgmcslagftqivnearipacsl

SCOPe Domain Coordinates for d4tsra_:

Click to download the PDB-style file with coordinates for d4tsra_.
(The format of our PDB-style files is described here.)

Timeline for d4tsra_: