Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Bacteroides fragilis [TaxId:272559] [272379] (2 PDB entries) |
Domain d4r36b_: 4r36 B: [272383] automated match to d4e6ua_ complexed with act, ca, pe5, pg0 |
PDB Entry: 4r36 (more details), 1.9 Å
SCOPe Domain Sequences for d4r36b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r36b_ b.81.1.0 (B:) automated matches {Bacteroides fragilis [TaxId: 272559]} misplayihpeakigenveiapfvyidrnvvigdnnkimananilygsrigngntifpga vigaipqdlkfkgeestaeigdnnlirenvtinrgtaakgrtivgnnnllmegvhvahda ligngcivgnstkmageiiiddnaiisanvlmhqfcrvggyvmiqggcrfskdippyiia grepiaysginiiglrrrgfsneiienihnayriiyqsglntsdaltkveaevpaspeie yivdfirnsergiir
Timeline for d4r36b_: