Lineage for d4r37a_ (4r37 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2080029Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2080030Protein automated matches [190967] (30 species)
    not a true protein
  7. 2080054Species Bacteroides fragilis [TaxId:272559] [272379] (2 PDB entries)
  8. 2080055Domain d4r37a_: 4r37 A: [272381]
    automated match to d4e6ua_
    complexed with act, ca, pe5, pg0, ud1

Details for d4r37a_

PDB Entry: 4r37 (more details), 1.9 Å

PDB Description: crystal structure analysis of lpxa, a udp-n-acetylglucosamine acyltransferase from bacteroides fragilis 9343 with udp-glcnac
PDB Compounds: (A:) Putative acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase

SCOPe Domain Sequences for d4r37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r37a_ b.81.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
misplayihpeakigenveiapfvyidrnvvigdnnkimananilygsrigngntifpga
vigaipqdlkfkgeestaeigdnnlirenvtinrgtaakgrtivgnnnllmegvhvahda
ligngcivgnstkmageiiiddnaiisanvlmhqfcrvggyvmiqggcrfskdippyiia
grepiaysginiiglrrrgfsneiienihnayriiyqsglntsdaltkveaevpaspeie
yivdfirnsergiir

SCOPe Domain Coordinates for d4r37a_:

Click to download the PDB-style file with coordinates for d4r37a_.
(The format of our PDB-style files is described here.)

Timeline for d4r37a_: