SCOPe 2.08: Domain d4r37a_: 4r37 A:

Lineage for d4r37a_ (4r37 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [272379] (2 PDB entries)

8. Domain d4r37a_: 4r37 A: [272381]
   automated match to d4e6ua_
   complexed with act, ca, pe5, pg0, ud1

Details for d4r37a_

PDB Entry: 4r37, 1.9 Å

PDB Description: crystal structure analysis of lpxa, a udp-n-acetylglucosamine acyltransferase from bacteroides fragilis 9343 with udp-glcnac

PDB Compounds: (A:) Putative acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase

SCOPe Domain Sequences for d4r37a_:

Sequence; same for both SEQRES and ATOM records:

>d4r37a_ b.81.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
misplayihpeakigenveiapfvyidrnvvigdnnkimananilygsrigngntifpga
vigaipqdlkfkgeestaeigdnnlirenvtinrgtaakgrtivgnnnllmegvhvahda
ligngcivgnstkmageiiiddnaiisanvlmhqfcrvggyvmiqggcrfskdippyiia
grepiaysginiiglrrrgfsneiienihnayriiyqsglntsdaltkveaevpaspeie
yivdfirnsergiir

Timeline for d4r37a_:

• d4r37a_ first appeared in SCOPe 2.05
  
• d4r37a_ appears in SCOPe 2.07