SCOPe 2.05: Domain d4qocg_: 4qoc G:

Lineage for d4qocg_ (4qoc G:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)

8. Domain d4qocg_: 4qoc G: [272371]
   automated match to d1t4ea_
   complexed with 35t

Details for d4qocg_

PDB Entry: 4qoc, 1.7 Å

PDB Description: crystal structure of compound 16 bound to mdm2(17-111), {(3r,5r,6s)-5- (3-chlorophenyl)-6-(4-chlorophenyl)-1-[(1s)-1-cyclopropyl-2- (pyrrolidin-1-ylsulfonyl)ethyl]-3-methyl-2-oxopiperidin-3-yl}acetic acid

PDB Compounds: (G:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4qocg_:

Sequence; same for both SEQRES and ATOM records:

>d4qocg_ a.42.1.1 (G:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

Timeline for d4qocg_:

• d4qocg_ is new in SCOPe 2.05-stable
  
• d4qocg_ appears in SCOPe 2.06
  
• d4qocg_ appears in the current release, SCOPe 2.08