SCOPe 2.06: Domain d4qafd_: 4qaf D:

Lineage for d4qafd_ (4qaf D:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
   Uniprot P15692 40-133

8. Domain d4qafd_: 4qaf D: [272368]
   automated match to d1katv_
   complexed with act, oma, so4

Details for d4qafd_

PDB Entry: 4qaf, 1.8 Å

PDB Description: crystal structure of an engineered lipocalin (anticalin) in complex with vegf(8-109)

PDB Compounds: (D:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4qafd_:

Sequence; same for both SEQRES and ATOM records:

>d4qafd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrp

Timeline for d4qafd_:

• d4qafd_ first appeared in SCOPe 2.05
  
• d4qafd_ appears in SCOPe 2.07
  
• d4qafd_ appears in the current release, SCOPe 2.08