Lineage for d4q70b_ (4q70 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979109Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1979153Species Thermosynechococcus elongatus [TaxId:197221] [189583] (9 PDB entries)
  8. 1979156Domain d4q70b_: 4q70 B: [272365]
    Other proteins in same PDB: d4q70a_
    automated match to d1ktpb_
    complexed with cyc

Details for d4q70b_

PDB Entry: 4q70 (more details), 1.85 Å

PDB Description: light harvesting protein phycocyanin in high resolution using a femtosecond x-ray laser
PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4q70b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q70b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d4q70b_:

Click to download the PDB-style file with coordinates for d4q70b_.
(The format of our PDB-style files is described here.)

Timeline for d4q70b_: