Lineage for d4q1gc_ (4q1g C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100072Species Bacillus subtilis [TaxId:224308] [272349] (5 PDB entries)
  8. 2100081Domain d4q1gc_: 4q1g C: [272362]
    automated match to d2q34a_
    complexed with edo, gol

Details for d4q1gc_

PDB Entry: 4q1g (more details), 2.1 Å

PDB Description: structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching
PDB Compounds: (C:) Polyketide biosynthesis enoyl-CoA isomerase PksI

SCOPe Domain Sequences for d4q1gc_:

Sequence, based on SEQRES records: (download)

>d4q1gc_ c.14.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
svvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltgydnyfa
sggtqegllriqqgltkftddnlyslaldceipviaamqghgigggfvmglfadivilsr
esvytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpfkvlpra
evldyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmhek

Sequence, based on observed residues (ATOM records): (download)

>d4q1gc_ c.14.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
svvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltgydnyfa
sggtqegllriqqgltddnlyslaldceipviaamqghgigggfvmglfadivilsresv
ytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpfkvlpraevl
dyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmhek

SCOPe Domain Coordinates for d4q1gc_:

Click to download the PDB-style file with coordinates for d4q1gc_.
(The format of our PDB-style files is described here.)

Timeline for d4q1gc_: