SCOPe 2.08: Domain d4q1ka1: 4q1k A:1-235

Lineage for d4q1ka1 (4q1k A:1-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [272349] (5 PDB entries)

8. Domain d4q1ka1: 4q1k A:1-235 [272360]
   Other proteins in same PDB: d4q1ka2
   automated match to d2q34a_
   complexed with gol, po4

Details for d4q1ka1

PDB Entry: 4q1k, 1.75 Å

PDB Description: structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching

PDB Compounds: (A:) Polyketide biosynthesis enoyl-CoA isomerase PksI

SCOPe Domain Sequences for d4q1ka1:

Sequence; same for both SEQRES and ATOM records:

>d4q1ka1 c.14.1.0 (A:1-235) automated matches {Bacillus subtilis [TaxId: 224308]}
mthsvvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltgydn
yfasggtqegllriqqgltkftddnlyslaldceipviaamqghgigggfvmglfadivi
lsresvytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpfkvl
praevldyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmheatfh

Timeline for d4q1ka1:

• d4q1ka1 first appeared in SCOPe 2.05, called d4q1ka_
  
• d4q1ka1 appears in SCOPe 2.07