SCOPe 2.07: Domain d2izgb_: 2izg B:

Lineage for d2izgb_ (2izg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d2izgb_: 2izg B: [27236]
   complexed with btn, so4

Details for d2izgb_

PDB Entry: 2izg, 1.36 Å

PDB Description: streptavidin-biotin ph 2.0 i222 complex

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2izgb_:

Sequence; same for both SEQRES and ATOM records:

>d2izgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2izgb_:

• d2izgb_ first appeared (with stable ids) in SCOP 1.55
  
• d2izgb_ appears in SCOPe 2.06
  
• d2izgb_ appears in the current release, SCOPe 2.08