Lineage for d4q1ja_ (4q1j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853629Species Bacillus subtilis [TaxId:224308] [272349] (5 PDB entries)
  8. 2853642Domain d4q1ja_: 4q1j A: [272354]
    automated match to d2q34a_
    complexed with edo, na

Details for d4q1ja_

PDB Entry: 4q1j (more details), 2.17 Å

PDB Description: structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching
PDB Compounds: (A:) Polyketide biosynthesis enoyl-CoA isomerase PksI

SCOPe Domain Sequences for d4q1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1ja_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mthsvvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltgydn
yfasggtqegllriqqgltkftddnlyslaldceipviaamqghgigggfvmglfadivi
lsresvytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpfkvl
praevldyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmaektfhheevk
srikglyg

SCOPe Domain Coordinates for d4q1ja_:

Click to download the PDB-style file with coordinates for d4q1ja_.
(The format of our PDB-style files is described here.)

Timeline for d4q1ja_: