SCOPe 2.07: Domain d4pfma_: 4pfm A:

Lineage for d4pfma_ (4pfm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Shewanella benthica [TaxId:314608] [272346] (1 PDB entry)

8. Domain d4pfma_: 4pfm A: [272348]
   automated match to d4icnb_
   complexed with flc, gol, lys, na

Details for d4pfma_

PDB Entry: 4pfm, 2.33 Å

PDB Description: shewanella benthica dhdps with lysine and pyruvate

PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d4pfma_:

Sequence; same for both SEQRES and ATOM records:

>d4pfma_ c.1.10.0 (A:) automated matches {Shewanella benthica [TaxId: 314608]}
hmingsivalitplnsdgtvdytsleklveyhitegtdaivavgttgesatlpisehiav
vgqtvkfasgripviggnganataeaieltkaqnklgvaamlgvtpyynkpspkgliahy
tavaastdipqilynvpgrtavdmlpetiaqlvevpniigvxdatgdvarvkqlrdlcgn
dfllysgddatarefltlggdgvisvannivpklfklmcdaalagdtqaamaaedqikgl
fsalfceanpipvkwaahkmglisqgdirlpltelstefhgllldamknarievk

Timeline for d4pfma_:

• d4pfma_ first appeared in SCOPe 2.05
  
• d4pfma_ appears in SCOPe 2.06
  
• d4pfma_ appears in the current release, SCOPe 2.08