Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Shewanella benthica [TaxId:314608] [272346] (1 PDB entry) |
Domain d4pfma_: 4pfm A: [272348] automated match to d4icnb_ complexed with flc, gol, lys, na |
PDB Entry: 4pfm (more details), 2.33 Å
SCOPe Domain Sequences for d4pfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pfma_ c.1.10.0 (A:) automated matches {Shewanella benthica [TaxId: 314608]} hmingsivalitplnsdgtvdytsleklveyhitegtdaivavgttgesatlpisehiav vgqtvkfasgripviggnganataeaieltkaqnklgvaamlgvtpyynkpspkgliahy tavaastdipqilynvpgrtavdmlpetiaqlvevpniigvxdatgdvarvkqlrdlcgn dfllysgddatarefltlggdgvisvannivpklfklmcdaalagdtqaamaaedqikgl fsalfceanpipvkwaahkmglisqgdirlpltelstefhgllldamknarievk
Timeline for d4pfma_: