Lineage for d4pc2b2 (4pc2 B:205-296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2063002Species Escherichia coli [TaxId:316385] [272315] (3 PDB entries)
  8. 2063008Domain d4pc2b2: 4pc2 B:205-296 [272343]
    Other proteins in same PDB: d4pc2a1, d4pc2a3, d4pc2b1, d4pc2b3, d4pc2c1, d4pc2c2, d4pc2c3, d4pc2d1, d4pc2d2, d4pc2d3
    automated match to d1efca1
    complexed with cl, gdp, gol

Details for d4pc2b2

PDB Entry: 4pc2 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with a bound gdp
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d4pc2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc2b2 b.43.3.0 (B:205-296) automated matches {Escherichia coli [TaxId: 316385]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4pc2b2:

Click to download the PDB-style file with coordinates for d4pc2b2.
(The format of our PDB-style files is described here.)

Timeline for d4pc2b2: