SCOPe 2.05: Domain d4pc2a1: 4pc2 A:8-204

Lineage for d4pc2a1 (4pc2 A:8-204)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Escherichia coli [TaxId:316385] [272313] (3 PDB entries)

8. Domain d4pc2a1: 4pc2 A:8-204 [272339]
   Other proteins in same PDB: d4pc2a2, d4pc2a3, d4pc2b2, d4pc2b3, d4pc2c1, d4pc2c2, d4pc2c3, d4pc2d1, d4pc2d2, d4pc2d3
   automated match to d1d8ta3
   complexed with cl, gdp, gol

Details for d4pc2a1

PDB Entry: 4pc2, 2.2 Å

PDB Description: elongation factor tu:ts complex with a bound gdp

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4pc2a1:

Sequence, based on SEQRES records:

>d4pc2a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 316385]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Sequence, based on observed residues (ATOM records):

>d4pc2a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 316385]}
tkphvnvgtighvdhgkttltaaittvlaktyggshveydtptrhyahvdcpghadyvkn
mitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelve
mevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

Timeline for d4pc2a1:

• d4pc2a1 is new in SCOPe 2.05-stable
  
• d4pc2a1 appears in SCOPe 2.06
  
• d4pc2a1 appears in the current release, SCOPe 2.08