SCOPe 2.05: Domain d4peoa_: 4peo A:

Lineage for d4peoa_ (4peo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.64: eIF1-like [55158] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243

4. Superfamily d.64.2: TM1457-like [118010] (1 family)
   forms a homodimer via alpha-helical interface
   automatically mapped to Pfam PF04327

5. Family d.64.2.1: TM1457-like [118011] (5 proteins)
   Pfam PF04327; DUF464

6. Protein automated matches [190707] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [272337] (1 PDB entry)

8. Domain d4peoa_: 4peo A: [272338]
   automated match to d2p92b_

Details for d4peoa_

PDB Entry: 4peo, 1.73 Å

PDB Description: crystal structure of a hypothetical protein from staphylococcus aureus.

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d4peoa_:

Sequence, based on SEQRES records:

>d4peoa_ d.64.2.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mitvditvndegkvtdvimdghadhgeyghdivcagasavlfgsvnaiigltserpdiny
ddngghfhirsvdtnndeaqlilqtmlvslqtieeeynenirlnyk

Sequence, based on observed residues (ATOM records):

>d4peoa_ d.64.2.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mitvditvndegkvtdvimdgagasavlfgsvnaiigltserpdinyddngghfhirsvd
tnndeaqlilqtmlvslqtieeeynnirlnyk

Timeline for d4peoa_:

• d4peoa_ is new in SCOPe 2.05-stable
  
• d4peoa_ appears in SCOPe 2.06
  
• d4peoa_ appears in the current release, SCOPe 2.08