Lineage for d4pc2c3 (4pc2 C:140-280)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189764Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2189765Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2189766Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 2189767Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 2189771Species Escherichia coli [TaxId:562] [54716] (6 PDB entries)
    duplication: consists of two subdomains of this fold
  8. 2189789Domain d4pc2c3: 4pc2 C:140-280 [272336]
    Other proteins in same PDB: d4pc2a1, d4pc2a2, d4pc2a3, d4pc2b1, d4pc2b2, d4pc2b3, d4pc2c1, d4pc2d1
    automated match to d1efub2
    complexed with cl, gdp, gol

Details for d4pc2c3

PDB Entry: 4pc2 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with a bound gdp
PDB Compounds: (C:) elongation factor ts

SCOPe Domain Sequences for d4pc2c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc2c3 d.43.1.1 (C:140-280) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamsk

SCOPe Domain Coordinates for d4pc2c3:

Click to download the PDB-style file with coordinates for d4pc2c3.
(The format of our PDB-style files is described here.)

Timeline for d4pc2c3: