![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
![]() | Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
![]() | Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins) |
![]() | Protein Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain [419040] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419524] (6 PDB entries) species duplication: consists of two subdomains of this fold |
![]() | Domain d4pc2c2: 4pc2 C:55-139 [272335] Other proteins in same PDB: d4pc2a1, d4pc2a2, d4pc2a3, d4pc2b1, d4pc2b2, d4pc2b3, d4pc2c1, d4pc2c3, d4pc2d1, d4pc2d3 automated match to d1efub4 complexed with cl, gdp, gol |
PDB Entry: 4pc2 (more details), 2.2 Å
SCOPe Domain Sequences for d4pc2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc2c2 d.43.1.1 (C:55-139) Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain {Escherichia coli [TaxId: 562]} vaadgviktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqf eeervalvakigeninirrvaaleg
Timeline for d4pc2c2: