Lineage for d4pc2c2 (4pc2 C:55-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945956Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2945957Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2945958Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins)
  6. 2945979Protein Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain [419040] (2 species)
  7. 2945983Species Escherichia coli [TaxId:562] [419524] (6 PDB entries)
    species duplication: consists of two subdomains of this fold
  8. 2945992Domain d4pc2c2: 4pc2 C:55-139 [272335]
    Other proteins in same PDB: d4pc2a1, d4pc2a2, d4pc2a3, d4pc2b1, d4pc2b2, d4pc2b3, d4pc2c1, d4pc2c3, d4pc2d1, d4pc2d3
    automated match to d1efub4
    complexed with cl, gdp, gol

Details for d4pc2c2

PDB Entry: 4pc2 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with a bound gdp
PDB Compounds: (C:) elongation factor ts

SCOPe Domain Sequences for d4pc2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc2c2 d.43.1.1 (C:55-139) Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain {Escherichia coli [TaxId: 562]}
vaadgviktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqf
eeervalvakigeninirrvaaleg

SCOPe Domain Coordinates for d4pc2c2:

Click to download the PDB-style file with coordinates for d4pc2c2.
(The format of our PDB-style files is described here.)

Timeline for d4pc2c2: