| Class b: All beta proteins [48724] (177 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (16 species) not a true protein |
| Species Escherichia coli [TaxId:316385] [272317] (3 PDB entries) |
| Domain d4pc6a3: 4pc6 A:297-393 [272330] Other proteins in same PDB: d4pc6a1, d4pc6a2, d4pc6b1, d4pc6b2, d4pc6c1, d4pc6c2, d4pc6c3, d4pc6d1, d4pc6d2, d4pc6d3 automated match to d1d8ta2 complexed with gnp, gol |
PDB Entry: 4pc6 (more details), 2.2 Å
SCOPe Domain Sequences for d4pc6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc6a3 b.44.1.0 (A:297-393) automated matches {Escherichia coli [TaxId: 316385]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d4pc6a3: