Lineage for d4pc6a3 (4pc6 A:297-393)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792580Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1792581Protein automated matches [254425] (14 species)
    not a true protein
  7. 1792595Species Escherichia coli [TaxId:316385] [272317] (3 PDB entries)
  8. 1792598Domain d4pc6a3: 4pc6 A:297-393 [272330]
    Other proteins in same PDB: d4pc6a1, d4pc6a2, d4pc6b1, d4pc6b2, d4pc6c1, d4pc6c2, d4pc6c3, d4pc6d1, d4pc6d2, d4pc6d3
    automated match to d1d8ta2
    complexed with gnp, gol

Details for d4pc6a3

PDB Entry: 4pc6 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with bound gdpnp
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4pc6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc6a3 b.44.1.0 (A:297-393) automated matches {Escherichia coli [TaxId: 316385]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4pc6a3:

Click to download the PDB-style file with coordinates for d4pc6a3.
(The format of our PDB-style files is described here.)

Timeline for d4pc6a3: