Lineage for d4pc1a3 (4pc1 A:297-393)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792580Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1792581Protein automated matches [254425] (14 species)
    not a true protein
  7. 1792595Species Escherichia coli [TaxId:316385] [272317] (3 PDB entries)
  8. 1792596Domain d4pc1a3: 4pc1 A:297-393 [272327]
    Other proteins in same PDB: d4pc1a1, d4pc1a2, d4pc1b1, d4pc1b2, d4pc1c1, d4pc1c2, d4pc1c3, d4pc1d1, d4pc1d2, d4pc1d3
    automated match to d1d8ta2
    complexed with gol, pb, po4, trs

Details for d4pc1a3

PDB Entry: 4pc1 (more details), 1.95 Å

PDB Description: elongation factor tu:ts complex with a bound phosphate
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4pc1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc1a3 b.44.1.0 (A:297-393) automated matches {Escherichia coli [TaxId: 316385]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4pc1a3:

Click to download the PDB-style file with coordinates for d4pc1a3.
(The format of our PDB-style files is described here.)

Timeline for d4pc1a3: