Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Escherichia coli [TaxId:316385] [272315] (3 PDB entries) |
Domain d4pc1a2: 4pc1 A:205-296 [272326] Other proteins in same PDB: d4pc1a1, d4pc1a3, d4pc1b1, d4pc1b3, d4pc1c1, d4pc1c2, d4pc1c3, d4pc1d1, d4pc1d2, d4pc1d3 automated match to d1efca1 complexed with gol, pb, po4, trs |
PDB Entry: 4pc1 (more details), 1.95 Å
SCOPe Domain Sequences for d4pc1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc1a2 b.43.3.0 (A:205-296) automated matches {Escherichia coli [TaxId: 316385]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d4pc1a2: