Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (27 species) not a true protein |
Species Escherichia coli [TaxId:316385] [272313] (3 PDB entries) |
Domain d4pc1a1: 4pc1 A:8-204 [272325] Other proteins in same PDB: d4pc1a2, d4pc1a3, d4pc1b2, d4pc1b3, d4pc1c1, d4pc1c2, d4pc1c3, d4pc1d1, d4pc1d2, d4pc1d3 automated match to d1d8ta3 complexed with gol, pb, po4, trs |
PDB Entry: 4pc1 (more details), 1.95 Å
SCOPe Domain Sequences for d4pc1a1:
Sequence, based on SEQRES records: (download)
>d4pc1a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 316385]} tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak ilelagfldsyipeper
>d4pc1a1 c.37.1.8 (A:8-204) automated matches {Escherichia coli [TaxId: 316385]} tkphvnvgtighvdhgkttltaaittvlaktyggshveydtptrhyahvdcpghadyvkn mitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelve mevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper
Timeline for d4pc1a1: